Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0711(Mj0711) Protein, His-Tagged
Cat.No. : | RFL23703MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0711(MJ0711) Protein (Q58121) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MDSVLSGKIVQILVGYLKENIYSEQMIKLRMKRICSYEEFLPTYSLIERITEESKEIAIK VYEKNIIVEIVKDFKNKDLIELFELKEELFDEALSYLKKYNADKFLESYTLYCFSEYSDP DSFIKENKSILTKLLRNQYEEVPEEYINELLKSKIKYSTKDLIILDWDNGIILDKNEDFW EEVDIIELACIRVLNLRVFDSMLSEAIQYFTRLQWEKLGYFKLKKLSKDLYLQRISYISY FDSIENVLMLYGDRYYAELYERLCKIFYVSEWIKRVEKKMEMISDIYTMTRQHLTEFYGL LLEGTIVALILLEIILALAKIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0711 |
Synonyms | MJ0711; Uncharacterized protein MJ0711 |
UniProt ID | Q58121 |
◆ Recombinant Proteins | ||
TNFRSF18-2090H | Active Recombinant Human TNFRSF18 protein, His-tagged | +Inquiry |
Igfbp6-3012R | Recombinant Rat Igfbp6 protein, His/T7-tagged | +Inquiry |
RFL646HF | Recombinant Full Length Human Olfactory Receptor 5D18(Or5D18) Protein, His-Tagged | +Inquiry |
HA-3363V | Recombinant Influenza A H1N1 (A/Tawain/01/1986) HA protein(Met1-Ser524), His-tagged | +Inquiry |
ESYT1-1814R | Recombinant Rat ESYT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
Collagen-225B | Native Bovine Type IV Collagen Protein | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
LRAT-4660HCL | Recombinant Human LRAT 293 Cell Lysate | +Inquiry |
ZKSCAN3-2005HCL | Recombinant Human ZKSCAN3 cell lysate | +Inquiry |
FAM20B-001HCL | Recombinant Human FAM20B cell lysate | +Inquiry |
UHRF2-507HCL | Recombinant Human UHRF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0711 Products
Required fields are marked with *
My Review for All MJ0711 Products
Required fields are marked with *
0
Inquiry Basket