Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0565(Mj0565) Protein, His-Tagged
Cat.No. : | RFL30930MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0565(MJ0565) Protein (Q57985) (1-147aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-147) |
Form : | Lyophilized powder |
AA Sequence : | MDIKNMRNVIVSLSLVFGLLFTVSGIIEIIIGLYSILGFKIELPLFVGDVFGGLALLAVG IAYFLGVKKAVDRDIKAVSYLFTASIIGLGIGVIAFLILISDAIGFLLGFEDWADWGFFN DLTVYLVLGMLAIIPYRIAKIISSSTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0565 |
Synonyms | MJ0565; Uncharacterized protein MJ0565 |
UniProt ID | Q57985 |
◆ Recombinant Proteins | ||
RFL10373LF | Recombinant Full Length Lachancea Kluyveri Pheromone Alpha Factor Receptor(Ste2) Protein, His-Tagged | +Inquiry |
GDPGP1 -631H | Recombinant Human GDPGP1 Protein, MYC/DDK-tagged | +Inquiry |
FGF7-189H | Recombinant Human FGF7 protein, His/S-tagged | +Inquiry |
CNPY4-1822M | Recombinant Mouse CNPY4 Protein, His (Fc)-Avi-tagged | +Inquiry |
THEMIS3-9188M | Recombinant Mouse THEMIS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
PPIH-2969HCL | Recombinant Human PPIH 293 Cell Lysate | +Inquiry |
LOC554223-1019HCL | Recombinant Human LOC554223 cell lysate | +Inquiry |
MAT2A-4454HCL | Recombinant Human MAT2A 293 Cell Lysate | +Inquiry |
CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0565 Products
Required fields are marked with *
My Review for All MJ0565 Products
Required fields are marked with *
0
Inquiry Basket