Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0018(Mj0018) Protein, His-Tagged
Cat.No. : | RFL35133MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0018(MJ0018) Protein (Q60324) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MIFKKRKGQLTLEFILLILGMTVVGIVITMGLVEKSPIFIGDKPLEVKKETMGLFINESK FNLTVENTTISNLGNNNTESNNSNNETGGGYLYIRVSGSSKGLITKDLIVSGDAKDVSGD ISKTINSKCVEENAIGEVYGDIYLEGSANYKLGNLLCINKFQTYLTGSGSLKVYVPYIQE FIIRDKNSGESQIGGSVSLTVGNTNINRFYVEKITGGAKVKFKDFAINTFETNSGNFGGG AETVFENGRISTMKLGDIVSGGNVKFKNVNIGNMIINNMIGSPTFELSNSTINNMKINKL IGSPKILVEDSSIINSLETDQLGGSDIEVKDGSIIKEITIHGSTGTNGKIFVGYGGKVEK LFVEGNINSRIDLKGFSGLIDVSIGNIAGGGKLYVDNVIGNSISTGIIGNNKGLEIEDSS LSVVNIEGVSNSGSAFIKNTLIYQLKINSLPDWGSDMTLNKVNITKLSINEIRNGKLTIK NSEIGELHITKISGKGKIIVKKSYVNGKYYKKLVIKKSNYKKWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0018 |
Synonyms | MJ0018; Uncharacterized protein MJ0018 |
UniProt ID | Q60324 |
◆ Recombinant Proteins | ||
Hmga2-1139M | Recombinant Mouse Hmga2 Protein, MYC/DDK-tagged | +Inquiry |
RFL19097SF | Recombinant Full Length Salmonella Typhimurium Protein Mgtc(Mgtc) Protein, His-Tagged | +Inquiry |
COL12A1-16H | Recombinant Human COL11A1 protein, His-tagged | +Inquiry |
CED40 | Recombinant Aeromonas CED40 protein | +Inquiry |
TRIM28-2658H | Recombinant Human TRIM28 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-26882TH | Native Human GPT | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
Adrenal-019H | Human Adrenal Lysate, Total Protein | +Inquiry |
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
Lecithin-10S | Native Soy Lecithin | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR66-1928HCL | Recombinant Human WDR66 cell lysate | +Inquiry |
CD180-2099HCL | Recombinant Human CD180 cell lysate | +Inquiry |
BCL2L12-8487HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
SLA2-1810HCL | Recombinant Human SLA2 293 Cell Lysate | +Inquiry |
PROK2-2835HCL | Recombinant Human PROK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0018 Products
Required fields are marked with *
My Review for All MJ0018 Products
Required fields are marked with *
0
Inquiry Basket