Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Abc Transporter Permease Mj1507(Mj1507) Protein, His-Tagged
Cat.No. : | RFL1046MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized ABC transporter permease MJ1507(MJ1507) Protein (Q58902) (1-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-399) |
Form : | Lyophilized powder |
AA Sequence : | MGKSMKVDDIITFAFKNIKQKRTQSLLTIIGIVIGVLAMVSLISLGYGVQNYIHEEMMKM GSNKITILPMKQFGVPPSHLFTKKEIKAIKNVKGVDTVMYGWYGGCEIEYNGEKKFVSYY YAIPSKLREVYKDSGYDIEEGRWLEDNDKYACVIGYGTAHNLFDREIKVGDVIKIKDKKF RVVGILKQIGNQQDDNSIILNIDVGEKLFGNEGKYNFISVTVKEGEDIEKVSEEIKKALK KSFGDEDFSVLTAEQLAKTVSSVLGVITIFVVGVAAISLLVGAVGISNTMHMSILERRKD IGILKALGAETTDILAIFVVESGFLGLFGGIVGLVLGILLAEVIEALAHKMGYLMVNAWI SWELIVGVLIFSFLVGVISGYFPARSGAKLNPIETLRGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1507 |
Synonyms | MJ1507; Uncharacterized ABC transporter permease MJ1507 |
UniProt ID | Q58902 |
◆ Recombinant Proteins | ||
B3GNT2-10103H | Recombinant Human B3GNT2, His-tagged | +Inquiry |
Colloidal silver-019 | Nonconjugated Colloidal silver (concentrated) | +Inquiry |
S-2009S | Active Recombinant SARS-CoV-2 P.1 Spike Protein, His-tagged, Alexa Fluor® 647 conjugated | +Inquiry |
MYLPF-5851M | Recombinant Mouse MYLPF Protein, His (Fc)-Avi-tagged | +Inquiry |
ADNP-365H | Recombinant Human ADNP Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
ACOT6-9088HCL | Recombinant Human ACOT6 293 Cell Lysate | +Inquiry |
HAT1-5631HCL | Recombinant Human HAT1 293 Cell Lysate | +Inquiry |
HYAL2-5323HCL | Recombinant Human HYAL2 293 Cell Lysate | +Inquiry |
COL9A3-7374HCL | Recombinant Human COL9A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MJ1507 Products
Required fields are marked with *
My Review for All MJ1507 Products
Required fields are marked with *
0
Inquiry Basket