Recombinant Full Length Mesocricetus Auratus Platelet Glycoprotein 4(Cd36) Protein, His-Tagged
Cat.No. : | RFL4071MF |
Product Overview : | Recombinant Full Length Mesocricetus auratus Platelet glycoprotein 4(CD36) Protein (P70110) (2-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mesocricetus auratus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-472) |
Form : | Lyophilized powder |
AA Sequence : | GCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLVEKTIKKEVVLEEGTIAFKNWVKTGTTVYRQFWIFDVQNPDEVAVNSSKIKVKQRGPYTYRVRYLAKENITQDPVDSTVSFVQPNGAIFEPSLSVGTENDTFTILNLAVAAAPHIYTNSFVQVVLNSLIKKSKSSMFQTRTLRELLWGYKDPFLSLVPYPIPTTVGVFYPYNDTADGVYKVFNGKDDINKVAIIDSYKGKRNLSYWESYCDMINGTDAASFPPFVEKSRVLRFFSSDICRSIYAVFGSDIELKGIPVYRFILPAKAFASPVQNPDNHCFCTEKVISNNCTSYGVLDISKCKQGRPVYISLPHFLHASPDISEPIEGLNPNEEEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRNYIVPILWLNETGTIGDEKAEMFRNQVTGKVKLLGLVEMVLLGLGVVMFVAFMISYCACRSKNRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD36 |
Synonyms | CD36; Platelet glycoprotein 4; Glycoprotein IIIb; GPIIIB; PAS IV; PAS-4; Platelet glycoprotein IV; GPIV; CD antigen CD36 |
UniProt ID | P70110 |
◆ Recombinant Proteins | ||
CD36-257H | Recombinant Human CD36 protein, His-tagged | +Inquiry |
Cd36-3323M | Active Recombinant Mouse Cd36 protein, His-tagged | +Inquiry |
Cd36-834M | Recombinant Mouse Cd36 Protein, MYC/DDK-tagged | +Inquiry |
CD36-57HF | Recombinant Full Length Human CD36 Protein, His-tagged | +Inquiry |
CD36-1957H | Recombinant Human CD36 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD36-2400MCL | Recombinant Mouse CD36 cell lysate | +Inquiry |
CD36-2539HCL | Recombinant Human CD36 cell lysate | +Inquiry |
CD36-1236RCL | Recombinant Rat CD36 cell lysate | +Inquiry |
CD36-1109CCL | Recombinant Cynomolgus CD36 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD36 Products
Required fields are marked with *
My Review for All CD36 Products
Required fields are marked with *
0
Inquiry Basket