Recombinant Full Length Meleagris Gallopavo Vasoactive Intestinal Polypeptide Receptor(Vipr1) Protein, His-Tagged
Cat.No. : | RFL14571MF |
Product Overview : | Recombinant Full Length Meleagris gallopavo Vasoactive intestinal polypeptide receptor(VIPR1) Protein (Q91085) (20-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meleagris gallopavo (Wild turkey) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-457) |
Form : | Lyophilized powder |
AA Sequence : | GLVVEVEVWWWRWRFGGGGCIMLEIEEERSQCPAEITEDNQTSGCRRQWDNITCWPEAQV GAVVVKPCPKYFRLLTTFLGNVSRNCTSQGWTDVYPAPYAVACGYDSTAHQGKEQTAFYG TVKTGYTIGHTLSLIALTAAMIILCLFRKLHCTRNYIHMHLFMSFIMRAIAVFIKDVTLF ESGEPEHCFVSSVGCKAMMVFFQYCVMANFFWLLVEGLYLHTLLVISFFSERKYFWWYIL IGWGAPSVFITAWTVVRIYFFNVGCWEEIIESPIWWIIKTPILVSILVNFILFICIIRIL VQKLHSPDVGHNETSQYSRLAKSTLLLIPLFGIHYIMFAFFPDNFKAQVKLVFELVVGSF QGFVVAVLYCFLNGEVQAELKRKWRRWHLERFLGSDMKYHHPSLGSNGTNFSTQISMLTK CSPKTRRCSSFQAEFSLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VIPR1 |
Synonyms | VIPR1; Vasoactive intestinal polypeptide receptor; VIP receptor; VIP-R |
UniProt ID | Q91085 |
◆ Recombinant Proteins | ||
VIPR1-6524R | Recombinant Rat VIPR1 Protein | +Inquiry |
VIPR1-18021M | Recombinant Mouse VIPR1 Protein | +Inquiry |
VIPR1-3686C | Recombinant Chicken VIPR1 | +Inquiry |
VIPR1-6180R | Recombinant Rat VIPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VIPR1-4973R | Recombinant Rhesus Macaque VIPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VIPR1-1908HCL | Recombinant Human VIPR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VIPR1 Products
Required fields are marked with *
My Review for All VIPR1 Products
Required fields are marked with *
0
Inquiry Basket