Recombinant Full Length Meleagris Gallopavo Beta-4C Adrenergic Receptor(Adrb4C) Protein, His-Tagged
Cat.No. : | RFL24765MF |
Product Overview : | Recombinant Full Length Meleagris gallopavo Beta-4C adrenergic receptor(ADRB4C) Protein (P43141) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meleagris gallopavo (Wild turkey) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MTPLPAGNGSVPNCSWAAVLSRQWAVGAALSITILVIVAGNLLVIVAIAKTPRLQTMTNV FVTSLACADLVMGLLVVPPGATILLSGHWPYGTVVCELWTSLDVLCVTASIETLCAIAVD RYLAITAPLQYEALVTKGRAWAVVCMVWAISAFISFLPIMNHWWRDGADEQAVRCYDDPR CCDFVTNMTYAIVSSTVSFYVPLLVMIFVYVRVFAVATRHVQLIGKDKVRFLQENPSLSS RGGRWRRPSRLLAIKEHKALKTLGIIMGTFTLCWLPFFVANIIKVFCRPLVPDQLFLFLN WLGYVNSAFNPIIYCRSPDFRSAFRKLLCCPRRADRRLHAAPQDPQHCSCAFSPRGDPME DSKAVDPGHLREDSEVQGSGRREENASSHGGGHQQRPLGECWLQGMQSMLCEQLDEFTST EMPAGPSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADRB4C |
Synonyms | ADRB4C; Beta-4C adrenergic receptor; Beta-4C adrenoreceptor; Beta-4C adrenoceptor |
UniProt ID | P43141 |
◆ Recombinant Proteins | ||
Pygl-7825R | Recombinant Rat Pygl protein, His-tagged | +Inquiry |
DSP-1195H | Recombinant Human DSP Protein, His-SUMO-tagged | +Inquiry |
STMN2-5797R | Recombinant Rat STMN2 Protein | +Inquiry |
NDUFAF3-5976M | Recombinant Mouse NDUFAF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUFT1-9769M | Recombinant Mouse TUFT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
TF-172S | Native Sheep transferrin | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
PLG-54H | Native Human glu-Plasminogen | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
LINC00471-8072HCL | Recombinant Human C2orf52 293 Cell Lysate | +Inquiry |
Colon Ascending-7H | Human Adult Colon Ascending Membrane Lysate | +Inquiry |
ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
CACNB1-7903HCL | Recombinant Human CACNB1 293 Cell Lysate | +Inquiry |
FLT3-2561HCL | Recombinant Human FLT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ADRB4C Products
Required fields are marked with *
My Review for All ADRB4C Products
Required fields are marked with *
0
Inquiry Basket