Recombinant Full Length Medicago Truncatula Calcium And Calcium/Calmodulin-Dependent Serine/Threonine-Protein Kinase Dmi-3(Dmi3) Protein, His-Tagged
Cat.No. : | RFL16708MF |
Product Overview : | Recombinant Full Length Medicago truncatula Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3(DMI3) Protein (Q6RET7) (1-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Medicago truncatula |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-523) |
Form : | Lyophilized powder |
AA Sequence : | MGYGTRKLSDEYEVSEILGRGGFSVVRKGTKKSSIEEEKSQSQVAIKTLRRLGASNNPSG LPRKKDIGEKSTIGFPTMRQVSVSDTLLTNEILVMRRIVENVSPHPNVIDLYDVYEDTNG VHLVLELCSGGELFDRIVAQDKYSETEAATVVHQIASGLEAVHRANIVHRDLKPENCLFL DVRKDSPLKIMDFGLSSVEEFTDPVVGLFGSIDYVSPEALSQGKITTKSDMWSLGVILYI LLSGYPPFIAQNNRQKQQMIMNGNFSFYEKTWKGISQPAKNLISSLLTVDPSKRPSALEL LSDPWVKGEKAKDVQMDPEIVSRLQSFNARRKLRAAAIASVWSSTIFLRTKKLKSLVGSY DLKEEEIENLRMHFKKICADRDNATLSEFEEVLKAMNMLSLIPFASRIFDLFDNNRDGTV DMREILCGFSSLKNSKGEDALRLCFQMYDTDRSGCISKEEVASMLRALPYDCLPTDITEP GKLDEIFDLMDANNDGKVTFDEFKAAMQRDSSLQDVVLSSIRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DMI3 |
Synonyms | CCAMK; DMI3; MTR_8g043970; Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3; CCaMK DMI3; MtCCaMK; Protein DOES NOT MAKE INFECTIONS 3 |
UniProt ID | Q6RET7 |
◆ Recombinant Proteins | ||
SULT2B1-3546H | Recombinant Human SULT2B1 protein, GST-tagged | +Inquiry |
SUMO2-1335S | Recombinant Human SUMO2 Protein (M1-Y95), His/Strep tagged | +Inquiry |
S-573S | Recombinant SARS-CoV-2 Spike RBD (P479H) Protein, His-tagged | +Inquiry |
SPOIIIAB-1530B | Recombinant Bacillus subtilis SPOIIIAB protein, His-tagged | +Inquiry |
HE-1236B | Recombinant Bovine Hemagglutinin-esterase Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LOX3-185G | Native Glycine max LOX3 Protein | +Inquiry |
Lectin-1849U | Active Native Ulex Europaeus Agglutinin I Protein, Agarose bound | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
ALB-5363B | Native Bovine Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT32-961HCL | Recombinant Human KRT32 cell lysate | +Inquiry |
STAU2-1413HCL | Recombinant Human STAU2 293 Cell Lysate | +Inquiry |
PPP2CB-2927HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
BEND4-295HCL | Recombinant Human BEND4 cell lysate | +Inquiry |
ERBB4-895RCL | Recombinant Rat ERBB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMI3 Products
Required fields are marked with *
My Review for All DMI3 Products
Required fields are marked with *
0
Inquiry Basket