Recombinant Full Length Marchantia Polymorpha Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL29399MF |
Product Overview : | Recombinant Full Length Marchantia polymorpha Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (P06414) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Marchantia polymorpha (Liverwort) (Marchantia aquatica) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALGGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEIVDTFPYFVSGVLHLISSAVLGFGGIYHAL IGPETLEESFPFFGYVWKDKNKMTTILGIHLILLGAGAFLLVFKALYFGGIYDTWAPGGG DVRKITNLTLSPGVIFGYLLKSPFGGEGWIVSVDNLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRALVWSGEAYLSYSLGAIAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYIMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLSKLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | P06414 |
◆ Native Proteins | ||
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFYVE20-175HCL | Recombinant Human ZFYVE20 293 Cell Lysate | +Inquiry |
Parotid-377C | Cynomolgus monkey Parotid Lysate | +Inquiry |
IL2RA-2907HCL | Recombinant Human IL2RA cell lysate | +Inquiry |
SERBP1-1950HCL | Recombinant Human SERBP1 293 Cell Lysate | +Inquiry |
Sp2-0-Ag14-1677M | Sp2/0-Ag14 (mouse hybridoma) whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket