Recombinant Full Length Manihot Esculenta 2-Methylbutanal Oxime Monooxygenase(Cyp71E7) Protein, His-Tagged
Cat.No. : | RFL35659MF |
Product Overview : | Recombinant Full Length Manihot esculenta 2-methylbutanal oxime monooxygenase(CYP71E7) Protein (Q6XQ14) (1-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Manihot esculenta (Cassava) (Jatropha manihot) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-511) |
Form : | Lyophilized powder |
AA Sequence : | MSVAILTSLPPQWLSILAVFLLPILTLLLFRGKDDNQKKGLKLPPGPRQLPLIGNLHQLG GQPYVDFWKMAKKYGPVMYLQLGRCPTVVLSSTETSKELMKDRDVECCSRPLSVGPGQLS YNFLDVAFSPYSDYWREMRKLFIFELLSMRRVQTFWYAREEQMDKMIEILDGAYPNPVNL TEKVFNMMDGIIGTIAFGRTTYAQQEFRDGFVKVLAATMDMLDNFHAENFFPVVGRFIDS LTGALAKRQRTFTDVDRYFEKVIEQHLDPNRPKPETEDIVDVLIGLMKDESTSFKITKDH VKAILMNVFVGGIDTSAVTITWAFSELLKNPKLMKKAQEEVRRAVGPNKRRVEGKEVEKI KYIDCIVKETFRKHPPVPLLVPHFSMKHCKIGGYDILPGTTIYVNAWAMGKDPTIWENPE EYNPDRFMNSEVDFRGSDFELVPFGAGRRICPGLAMGTTAVKYILSNLLYGWDYEMPRGK KFEDFPLIEEGGLTVHNKQDIMVIPKKHKWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP71E7 |
Synonyms | CYP71E7; c15; 2-methylbutanal oxime monooxygenase; Cytochrome P450 71E7 |
UniProt ID | Q6XQ14 |
◆ Native Proteins | ||
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-300C | Cynomolgus monkey Liver Membrane Lysate | +Inquiry |
MOLT-4-021HCL | Human MOLT-4 Whole Cell Lysate | +Inquiry |
E2F4-6741HCL | Recombinant Human E2F4 293 Cell Lysate | +Inquiry |
TGFBR3-1847MCL | Recombinant Mouse TGFBR3 cell lysate | +Inquiry |
KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP71E7 Products
Required fields are marked with *
My Review for All CYP71E7 Products
Required fields are marked with *
0
Inquiry Basket