Recombinant Full Length Maltose Transport System Permease Protein Malg(Malg) Protein, His-Tagged
Cat.No. : | RFL33706SF |
Product Overview : | Recombinant Full Length Maltose transport system permease protein malG(malG) Protein (P68186) (1-296aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-296) |
Form : | Lyophilized powder |
AA Sequence : | MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWK LALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKAT LLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGY FETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV NSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | malG |
Synonyms | malG; SF4173; S3558; Maltose/maltodextrin transport system permease protein MalG |
UniProt ID | P68186 |
◆ Native Proteins | ||
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
GG-187B | Native Bovine Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf1-8356HCL | Recombinant Human C11orf1 293 Cell Lysate | +Inquiry |
PDE6A-3347HCL | Recombinant Human PDE6A 293 Cell Lysate | +Inquiry |
CLIP2-365HCL | Recombinant Human CLIP2 cell lysate | +Inquiry |
NDC80-952HCL | Recombinant Human NDC80 cell lysate | +Inquiry |
COLEC12-403RCL | Recombinant Rat COLEC12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All malG Products
Required fields are marked with *
My Review for All malG Products
Required fields are marked with *
0
Inquiry Basket