Recombinant Full Length Maize Streak Virus Genotype B Movement Protein(V2) Protein, His-Tagged
Cat.No. : | RFL24809MF |
Product Overview : | Recombinant Full Length Maize streak virus genotype B Movement protein(V2) Protein (Q9IGY9) (1-101aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Maize streak virus genotype B (isolate Tas) (MSV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-101) |
Form : | Lyophilized powder |
AA Sequence : | MDPQNSFLLQPRVPTAAPTSGGVSWSRVGEVAILSFVGLICFYLLYLWVLRDLILVLKAR QGRSTEELIFGIQAVDRSNPIPNTQAPPSQGNPGPFVPGTG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | V2 |
Synonyms | V2; Movement protein; MP |
UniProt ID | Q9IGY9 |
◆ Recombinant Proteins | ||
MTA2-10162M | Recombinant Mouse MTA2 Protein | +Inquiry |
OAS1A-6293M | Recombinant Mouse OAS1A Protein, His (Fc)-Avi-tagged | +Inquiry |
NPHP1-6620HF | Recombinant Full Length Human NPHP1 Protein, GST-tagged | +Inquiry |
CACNA1H-2874H | Recombinant Human CACNA1H protein, His-tagged | +Inquiry |
NXPH2-710H | Recombinant Human NXPH2 | +Inquiry |
◆ Native Proteins | ||
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
HPX-29307TH | Native Human HPX | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
H2AFV-5660HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
CYP46A1-7105HCL | Recombinant Human CYP46A1 293 Cell Lysate | +Inquiry |
TDGF1-2432HCL | Recombinant Human TDGF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All V2 Products
Required fields are marked with *
My Review for All V2 Products
Required fields are marked with *
0
Inquiry Basket