Recombinant Full Length Magnesium Transport Protein Cora(Cora) Protein, His-Tagged
Cat.No. : | RFL24549BF |
Product Overview : | Recombinant Full Length Magnesium transport protein CorA(corA) Protein (Q7VRM7) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Blochmannia floridanus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MFNIFQLKNNCLFRMDSQDVISSINDVIWIDIIQSDDNESHDIQSISEQFKINFFEIKDI LKNKRFCNSKQGVYIRSFFFSYNEDNQIDNSIVSFIICNNCLYTLRESGFSVFCIYQESL NNHVLNDGNAYELLLSLFEVKIDDLTDRIEHIYETLERLSFVIMDEQQIDGYDSILEDLA KLESMSWKIHINLLDTERALQFLVRKVKLPVTQKRHANGILRGITLLLPYNECIFQKVSF LTQSVMGLINIEQNRIIKIFSIVFLPPTLIASSYGMNFEFMPELKWSFGYPSAIFLMILT GLAPYLYFKYKKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | corA |
Synonyms | corA; Bfl577; Magnesium transport protein CorA |
UniProt ID | Q7VRM7 |
◆ Recombinant Proteins | ||
PDE7A-3351R | Recombinant Rhesus monkey PDE7A Protein, His-tagged | +Inquiry |
ATP4B-5988C | Recombinant Chicken ATP4B | +Inquiry |
Cd274-593MP | Recombinant Mouse Cd274 protein, Fc-His-tagged, R-PE labeled | +Inquiry |
Angptl4-153M | Recombinant Mouse Angptl4 Protein, His-tagged | +Inquiry |
TSPAN11-1797H | Recombinant Human TSPAN11 | +Inquiry |
◆ Native Proteins | ||
PLG-8H | Native Human Plasminogen, FITC Labeled | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
HB-01H | Native Human HB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPA2-5213HCL | Recombinant Human IMPA2 293 Cell Lysate | +Inquiry |
GUCA1C-5678HCL | Recombinant Human GUCA1C 293 Cell Lysate | +Inquiry |
DDR1-001HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
WNT2-298HCL | Recombinant Human WNT2 293 Cell Lysate | +Inquiry |
SNAPC1-1638HCL | Recombinant Human SNAPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All corA Products
Required fields are marked with *
My Review for All corA Products
Required fields are marked with *
0
Inquiry Basket