Recombinant Full Length Magnaporthe Oryzae Nadh-Cytochrome B5 Reductase 1(Cbr1) Protein, His-Tagged
Cat.No. : | RFL13457MF |
Product Overview : | Recombinant Full Length Magnaporthe oryzae NADH-cytochrome b5 reductase 1(CBR1) Protein (A4R935) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Magnaporthe oryzae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MAPPLSSKVYVDGVYIPAALIVIGTAIVKRDWVVYSVALALALGTWKFFQLKPKKVLDPT KFQEFELKEKTIISHNVAIYRIQLPSPSSILGLPIGQHISIGADIPQPDGSSKEVVRSYT PISGDEQPGYVDLLIKSYPTGNISKYMAGLSVGQSIRVRGPKGAFVYQPNMVRHFGMIAG GTGITPMLQVVRAIVRGRAAGDTTQVDLIFANVTKEDILLKEDLDALAAEDKGFRVHYVL DRPPEGWTGGVGFVTQDMITKWLPKPADDVKILLCGPPPMVSGLKKATEALGFKKARPVS KLEDQVFAF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBR1 |
Synonyms | CBR1; MGG_06289; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase |
UniProt ID | A4R935 |
◆ Recombinant Proteins | ||
CBR1-143H | Recombinant Human CBR1, MYC/DDK-tagged | +Inquiry |
CBR1-26327TH | Recombinant Human CBR1 | +Inquiry |
CBR1-2494C | Recombinant Chicken CBR1 | +Inquiry |
Cbr1-592M | Recombinant Mouse Cbr1 Protein, His-tagged | +Inquiry |
RFL3438AF | Recombinant Full Length Aspergillus Clavatus Nadh-Cytochrome B5 Reductase 1(Cbr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBR1-288HCL | Recombinant Human CBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBR1 Products
Required fields are marked with *
My Review for All CBR1 Products
Required fields are marked with *
0
Inquiry Basket