Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL9774YF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q7CJG3) (1-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-678) |
Form : | Lyophilized powder |
AA Sequence : | MTGPQQGKILLRLENVSREFITGEQTVRVLNNINLTLHSGEMVAIVGTSGSGKSTLMNIL GCLDKPSAGEYWVAGRIPQYLGSDALAELRREHFGFIFQRYHLLNDLSARENVEIPAIYA GIDREERRKRAVNLLSRIGLAERLDYRPSQLSGGQQQRVSIARALMNGGDVILADEPTGA LDTHSGNEVLNILKDLHQQGHTVVIVTHDMSIAEHAQRIIELKDGEIIADRPRDHAQEKP KMVDIPSVIDIPSMDEKISTGAQQETEIARKPLLTRWKVQYDRLHEAFKMAILAMAAQRL RTALTMLGIIIGIASVVSVVALGKGSQQQVLANINAMGTSTLEIFPGKDFGDMRSAAIHT LRDTDADVLAQQGYIHSVTPTVSTSVTLRYGNKSVSGTVNGVGEQYFLVRGYTIAQGMAF TRTSVNDLMQDAVIDENTRDKLFPNGETPLGKVILLGSLPCRVIGVAAKKQSGFGSDENL NVWIPYTTAMKRMLGQSYLKSITVRVNDDIDLANAEQGVIKLLSQRHGTQDFFVMNTDSI RQTIQATTSTMTLLVSMIAVISLIVGGIGVMNIMLVSVTERTKEIGVRMAVGARASDIMQ QFLIEAVLVCLLGGSLGVALSLGIGLLFSLFSSNFSMVYSAASIITAFVCSSLIGVIFGF FPAKRAAEMDPIRALERE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; YPO3000; y1480; YP_2625; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q7CJG3 |
◆ Recombinant Proteins | ||
BCHE-0622H | Recombinant Human BCHE Protein (Glu29-Thr150), His-tagged | +Inquiry |
PCOLCE2-3807H | Recombinant Human PCOLCE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NRAS-1544H | Recombinant Human NRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
IL15 R alpha-2203M | Active Recombinant Mouse IL15 R alpha protein, Fc-tagged | +Inquiry |
SPSB2-15951M | Recombinant Mouse SPSB2 Protein | +Inquiry |
◆ Native Proteins | ||
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF5-6630HCL | Recombinant Human ELF5 293 Cell Lysate | +Inquiry |
ARMC8-8698HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
Pituitary-383H | Human Pituitary Membrane Lysate | +Inquiry |
HOOK3-5433HCL | Recombinant Human HOOK3 293 Cell Lysate | +Inquiry |
BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket