Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL35826YF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q668L6) (1-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pseudotuberculosis Serotype I |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-678) |
Form : | Lyophilized powder |
AA Sequence : | MTGPQQGKILLRLENVSREFITGEQTVRVLNNINLTLHSGEMVAIVGTSGSGKSTLMNIL GCLDKPSAGEYWVAGRIPQYLGSDALAELRREHFGFIFQRYHLLNDLSARENVEIPAIYA GIDREERRKRAVNLLSRIGLAERLDYRPSQLSGGQQQRVSIARALMNGGDVILADEPTGA LDTHSGNEVLNILKDLHQQGHTVVIVTHDMSIAEHAQRIIELKDGEIIADRPRDHAQEKP KMVDIPSVIDIPSMDEKISTGAQQETEIARKPLLTRWKVQYDRLHEAFKMAILAMAAQRL RTALTMLGIIIGIASVVSVVALGKGSQQQVLANINAMGTSTLEIFPGKDFGDMRSAAIHT LRDTDADVLAQQGYIHSVTPTVSTSVTLRYGNKSVSGTVNGVGEQYFLVRGYTIAQGMAF TRTSVNDLMQEAVIDENTRDKLFPNGETPLGKVILLGSLPCRVIGVAAKKQSGFGSDENL NVWIPYTTAMKRMLGQSYLKSITVRVNDDIDLANAEQGVIKLLSQRHGTQDFFVMNTDSI RQTIQATTSTMTLLVSMIAVISLIVGGIGVMNIMLVSVTERTKEIGVRMAVGARASDIMQ QFLIEAVLVCLLGGSLGVALSLGIGLLFSLFSSNFSMVYSAASIITAFVCSSLIGVIFGF FPAKRAAEMDPIRALERE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; YPTB2721; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q668L6 |
◆ Recombinant Proteins | ||
LTA4H-12477Z | Recombinant Zebrafish LTA4H | +Inquiry |
ANXA7-49C | Recombinant Cynomolgus Monkey ANXA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAG3-1824H | Recombinant Human BCL2-associated Athanogene 3, His tagged | +Inquiry |
TNC-311H | Recombinant Human Transthyretin (Wild Type) Protein, 13C, 15N Label | +Inquiry |
HSD11B1-5060H | Recombinant Human HSD11B1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Banana-683P | Banana Lysate, Total Protein | +Inquiry |
PLEKHM1P-1021HCL | Recombinant Human PLEKHM1P cell lysate | +Inquiry |
PRPF4B-2824HCL | Recombinant Human PRPF4B 293 Cell Lysate | +Inquiry |
YKT6-243HCL | Recombinant Human YKT6 293 Cell Lysate | +Inquiry |
RNF20-1524HCL | Recombinant Human RNF20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket