Recombinant Full Length Macaca Fascicularis Udp-Glucuronosyltransferase 2B9(Ugt2B9) Protein, His-Tagged
Cat.No. : | RFL10294MF |
Product Overview : | Recombinant Full Length Macaca fascicularis UDP-glucuronosyltransferase 2B9(UGT2B9) Protein (O02663) (22-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-529) |
Form : | Lyophilized powder |
AA Sequence : | SCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSASILFDPNNSSALKIEVFPTSL TKTEFENISMQEVKRWIELPKDTFWLYFSQMQEIMWRFGDIIRNFCKDVVSNKKLMKKLQ ESRFDVVFADPIFPCSELLAELFNIPLVYSLRFTPGYIFEKHCGGFLFPPSYVPVVMSEL SDQMTFMERVKNMIYMLSFDFYFQMYDMKKWDQFYSEVLGRPTTLSETMGKADIWLIRNS WNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVTNMEEERA NVIASALAQIPQKVLWRFDGKKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIY EAIYHGVPMVGIPLFADQPDNIAHMKTKGAAVRLDFDTMSSTDLANRLKTVINDPLYKEN VMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWFQYHSLDVIGFLLACV ATVIFVIMKCCLFCFWKFARKGKKGKSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2B9 |
Synonyms | UGT2B9; UDP-glucuronosyltransferase 2B9; UDPGT 2B9 |
UniProt ID | O02663 |
◆ Recombinant Proteins | ||
NOPCHAP1-1753HF | Recombinant Full Length Human NOPCHAP1 Protein, GST-tagged | +Inquiry |
Erbb2-4098RAF488 | Recombinant Rat Erbb2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
BCL2L11-2582H | Recombinant Human BCL2L11 protein, His-SUMO-tagged | +Inquiry |
SH3BP5-1761H | Recombinant Human SH3BP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADO-366H | Recombinant Human ADO Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSF3-1001HCL | Recombinant Human ACSF3 cell lysate | +Inquiry |
ORC3L-1259HCL | Recombinant Human ORC3L cell lysate | +Inquiry |
MFAP1-4353HCL | Recombinant Human MFAP1 293 Cell Lysate | +Inquiry |
CDKL3-329HCL | Recombinant Human CDKL3 cell lysate | +Inquiry |
IL23R-1213HCL | Recombinant Human IL23R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B9 Products
Required fields are marked with *
My Review for All UGT2B9 Products
Required fields are marked with *
0
Inquiry Basket