Recombinant Full Length Macaca Fascicularis Udp-Glucuronosyltransferase 2B23(Ugt2B23) Protein, His-Tagged
Cat.No. : | RFL16417MF |
Product Overview : | Recombinant Full Length Macaca fascicularis UDP-glucuronosyltransferase 2B23(UGT2B23) Protein (Q9TSL6) (25-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-529) |
Form : | Lyophilized powder |
AA Sequence : | KVLVWAAEYSHWMNMKTILEELVQRGHEVTALASSASILFDPNNSSALKIEVFPTSLPKP EFENIVTQEIKRWIELPKDTFWLYFSQMQEIMWKFGDIFRNFCKDVVSNKKLMKKLQESR FDVVFADPIFPCSELLAELFNIPLVYSLRFTPGYVFEKHCGGFLFPPSYVPVVMSELSDQ MTFMERVKNMIYMLYFDFCFQIYDMKKWDQFYTEVLGRHTTLSEIMGKADIWLIRNSWNF QFPHPLLPNVDFIGGLLCKPAKPLPKEMEEFVQSSGENGVVVFTLGSMITNMKEERANVI ASALAQIPQKVLWRFDGNKPDTLGVNTRLYKWIPQNDLLGHPKTKAFITHGGANGIYEAI YHGVPMVGIPLFADQPDNIAHMKTRGAAVQLDFDTMSSTDLVNALKTVINDPLYKENVMK LSRIQRDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWFQYHSFDVIGFLLACVATV IFIIMKCCLFCFWKFARKGKKGKSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2B23 |
Synonyms | UGT2B23; UDP-glucuronosyltransferase 2B23; UDPGT 2B23 |
UniProt ID | Q9TSL6 |
◆ Recombinant Proteins | ||
THRSP-8073H | Recombinant Human THRSP protein, His & T7-tagged | +Inquiry |
ZCCHC16-5271R | Recombinant Rhesus monkey ZCCHC16 Protein, His-tagged | +Inquiry |
L3MBTL4-142H | Recombinant Human L3MBTL4 Protein, HIS-tagged | +Inquiry |
TGM7-909H | Recombinant Human TGM7 Protein, MYC/DDK-tagged | +Inquiry |
RFL12410SF | Recombinant Full Length Salmonella Agona Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDHC-28045TH | Native Human LDHC | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SF3B3-1916HCL | Recombinant Human SF3B3 293 Cell Lysate | +Inquiry |
LMAN2-4718HCL | Recombinant Human LMAN2 293 Cell Lysate | +Inquiry |
Spinal-655B | Bovine Spinal Cord Lysate, Total Protein | +Inquiry |
NR2C2-3713HCL | Recombinant Human NR2C2 293 Cell Lysate | +Inquiry |
C6orf195-7989HCL | Recombinant Human C6orf195 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B23 Products
Required fields are marked with *
My Review for All UGT2B23 Products
Required fields are marked with *
0
Inquiry Basket