Recombinant Full Length Loligo Forbesi Rhodopsin(Rho) Protein, His-Tagged
Cat.No. : | RFL1436LF |
Product Overview : | Recombinant Full Length Loligo forbesi Rhodopsin(RHO) Protein (P24603) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Loligo forbesi (Northern European squid) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MGRDIPDNETWWYNPYMDIHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFT KTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGL MSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLE GVLCNCSFDYITRDTTTRSNILCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKR LNAKELRKAQAGANAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLP VMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQS GGETADAAQMKEMMAMMQKMQAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPP QGYPPPPQGPPPQGPPPQAAPPQGVDNQAYQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RHO |
Synonyms | RHO; Rhodopsin |
UniProt ID | P24603 |
◆ Recombinant Proteins | ||
RAPGEF3-4586R | Recombinant Rat RAPGEF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TFAM-301323H | Recombinant Human TFAM protein, GST-tagged | +Inquiry |
CHRM1-3424M | Recombinant Mouse CHRM1 Protein | +Inquiry |
CLFA-2141S | Recombinant Staphylococcus Aureus CLFA Protein (228-558 aa), His-SUMO-tagged | +Inquiry |
SLC10A5-8211M | Recombinant Mouse SLC10A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ALPI-8341C | Native Calf ALPI | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR46-345HCL | Recombinant Human WDR46 293 Cell Lysate | +Inquiry |
RPS6KA2-610HCL | Recombinant Human RPS6KA2 cell lysate | +Inquiry |
NPHS2-1211HCL | Recombinant Human NPHS2 cell lysate | +Inquiry |
IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
Pine-705P | Pine Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHO Products
Required fields are marked with *
My Review for All RHO Products
Required fields are marked with *
0
Inquiry Basket