Recombinant Full Length Lithobates Berlandieri Probable Glutamate Receptor Protein, His-Tagged
Cat.No. : | RFL11082LF |
Product Overview : | Recombinant Full Length Lithobates berlandieri Probable glutamate receptor Protein (P20262) (18-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lithobates berlandieri (Rio Grande leopard frog) (Rana berlandieri) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-487) |
Form : | Lyophilized powder |
AA Sequence : | HTDGKENAETLLKERTKRQIPKTLTVTTILEKPFAMKTESDALEGYAIDLLSELTQSLGF NYTLHIVKDGKYGSKDQEGNWSGMVGEIIRKEADLAIAPLTITSVRENAISFTKPFMQTG IGILLKKDTAAESSYMFGFLNPFSKELWIGIIISYVITSLCLFLVGRLSPCEWTEPASEQ NQFTLLNSLWYGVGALTLQGAEPQPKALSARIIAVIWWVFSITLLAAYIGSFASYINSNT NQTPNIQSVEDLLKQDKLDFGTLSNSSTLNFFKNSKNPTFQMIYEYMDKRKDRVLVKTFS EGVQRVRESNYAFLGESISQDFVVAKHCDLIRAPEMIGGRGYGIAAELDSPLIRPLTIAI LELFESGKLEYLRQKWWENTCSTQDQTGWVPVQPHTLGGIFLILGIGLALGLIVSFMELM CKSRSNAEQQKKSCCSAFSEEIAQRFGKTQNQEGLEKKSPTSNSCDEVKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lithobates berlandieri Probable glutamate receptor |
Synonyms | Probable glutamate receptor; Kainate-binding protein; KBP |
UniProt ID | P20262 |
◆ Native Proteins | ||
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPA4-7320HCL | Recombinant Human CPA4 293 Cell Lysate | +Inquiry |
NUDT22-3645HCL | Recombinant Human NUDT22 293 Cell Lysate | +Inquiry |
MFN1-4348HCL | Recombinant Human MFN1 293 Cell Lysate | +Inquiry |
STMN2-1396HCL | Recombinant Human STMN2 293 Cell Lysate | +Inquiry |
ZNRD1-9194HCL | Recombinant Human ZNRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Lithobates berlandieri Probable glutamate receptor Products
Required fields are marked with *
My Review for All Lithobates berlandieri Probable glutamate receptor Products
Required fields are marked with *
0
Inquiry Basket