Recombinant Full Length Listeria Monocytogenes Serovar 1/2A Upf0754 Membrane Protein Lmo2224(Lmo2224) Protein, His-Tagged
Cat.No. : | RFL20374LF |
Product Overview : | Recombinant Full Length Listeria monocytogenes serovar 1/2a UPF0754 membrane protein lmo2224(lmo2224) Protein (Q8Y552) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria Monocytogenes Serovar 1/2a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MSVLFTILLMAVIGGFIGAMTNYIAIRMLFRPYKAIYLFNKRLPFTPGLIPKRRDELAEH IGKVVVSHLLTEDAIRARLLDENLQKEITDTITKMFHEKMKLETTPNELLHHFGYENAEI RSMAWIEKTLEKEINHFLSTKKTTKMSDLIPTMLESELTTKLPHVTERITSKMTLFVASE EGKIQIKQMLQKFFEEHGKMGSMARMFINIDSFSEKIQQEGLKLIGQEDTKNLINQLLTT EWKNFEAKELQELIPTEKQAHLAGQLTSELIQTLPHEKLFNQPIQVILRGYEAAITEKVI PFAVERMLDFVATHSAEIVERMDLAKLVETQIATFSLPEIEKLVVEISGRELKMITYLGG ILGGFIGIIQGILAMWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lmo2224 |
Synonyms | lmo2224; UPF0754 membrane protein lmo2224 |
UniProt ID | Q8Y552 |
◆ Recombinant Proteins | ||
AAV2gp07-7832A | Recombinant Adeno-associated virus AAV2gp07 protein, His-tagged | +Inquiry |
APOE-726R | Recombinant Full Length Rat apolipoprotein E Protein, His tagged | +Inquiry |
HSPBAP1-2955R | Recombinant Rat HSPBAP1 Protein | +Inquiry |
NI36-RS02400-0814S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS02400 protein, His-tagged | +Inquiry |
MTAP1A-5764M | Recombinant Mouse MTAP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IBVT5399-230I | Native nfluenza (B/Tokio/53/99) IBVT5399 protein | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42-7655HCL | Recombinant Human CDC42 293 Cell Lysate | +Inquiry |
NLGN3-2082HCL | Recombinant Human NLGN3 cell lysate | +Inquiry |
TM4SF1-667HCL | Recombinant Human TM4SF1 lysate | +Inquiry |
ZNF777-2088HCL | Recombinant Human ZNF777 cell lysate | +Inquiry |
DBN1-217HCL | Recombinant Human DBN1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lmo2224 Products
Required fields are marked with *
My Review for All lmo2224 Products
Required fields are marked with *
0
Inquiry Basket