Recombinant Full Length Liriodendron Tulipifera Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL13335LF |
Product Overview : | Recombinant Full Length Liriodendron tulipifera NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q0G9G4) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Liriodendron tulipifera (Tuliptree) (Tulip poplar) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQAINSFSRSESLKEVYGLVWLLVPIFTPVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDIRLFSIGPSIAVISILLSYSVIPFGY RLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVL SISLLSNSSSTVDIVEAQSKYGFGGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKSGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFIPELFGINKTGGV FGTTIGIFITLAKAYLFLFIPITTRWTLPRMRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q0G9G4 |
◆ Recombinant Proteins | ||
GAMT-1809R | Recombinant Rhesus monkey GAMT Protein, His-tagged | +Inquiry |
AMH-4035HFL | Recombinant Full Length Human AMH protein, Flag-tagged | +Inquiry |
SMARCB1-3763H | Recombinant Human SMARCB1 protein, GST-tagged | +Inquiry |
UBTD2-818Z | Recombinant Zebrafish UBTD2 | +Inquiry |
CLDN5-1436R | Recombinant Rat CLDN5 Protein | +Inquiry |
◆ Native Proteins | ||
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
SYT6-647HCL | Recombinant Human SYT6 lysate | +Inquiry |
GNA13-720HCL | Recombinant Human GNA13 cell lysate | +Inquiry |
MLH1-4295HCL | Recombinant Human MLH1 293 Cell Lysate | +Inquiry |
NRP2-937HCL | Recombinant Human NRP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket