Recombinant Full Length Limnocottus Bergianus Rhodopsin(Rho) Protein, His-Tagged
Cat.No. : | RFL4652LF |
Product Overview : | Recombinant Full Length Limnocottus bergianus Rhodopsin(rho) Protein (O42427) (1-289aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Limnocottus bergianus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-289) |
Form : | Lyophilized powder |
AA Sequence : | YLVNPAGYAALGAYMFLLILIGSPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYSVLGRLGCILEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRPEKEVTRMVVIMVIAFLVCCLPNA SVAWWIFCNQGSDFGPIFMTLPSFFAKSAAIYNPMIYICMNKQFRHCMI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rho |
Synonyms | rho; Rhodopsin; Fragment |
UniProt ID | O42427 |
◆ Recombinant Proteins | ||
RHO-14166M | Recombinant Mouse RHO Protein | +Inquiry |
RFL28000IF | Recombinant Full Length Ictalurus Punctatus Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
RHO-3431H | Recombinant Human RHO protein, His-SUMO-tagged | +Inquiry |
RFL28817PF | Recombinant Full Length Procambarus Milleri Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
RHO-857C | Recombinant Cynomolgus RHO Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rho Products
Required fields are marked with *
My Review for All rho Products
Required fields are marked with *
0
Inquiry Basket