Recombinant Full Length Lepidium Virginicum Photosystem Q(B) Protein Protein, His-Tagged
Cat.No. : | RFL2957LF |
Product Overview : | Recombinant Full Length Lepidium virginicum Photosystem Q(B) protein Protein (A4QL86) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lepidium virginicum (Virginia pepperweed) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MTAILERRETESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA |
Synonyms | psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein |
UniProt ID | A4QL86 |
◆ Recombinant Proteins | ||
RFL31671SF | Recombinant Full Length Saccharomyces Cerevisiae 3-Ketodihydrosphingosine Reductase Tsc10(Tsc10) Protein, His-Tagged | +Inquiry |
REN-1207D | Recombinant Dog REN Protein, His-tagged | +Inquiry |
Mag-476M | Recombinant Mouse Mag Protein, Fc-tagged | +Inquiry |
KAT2B-1654H | Recombinant Human K (lysine) Acetyltransferase 2B | +Inquiry |
HMOX2-2873R | Recombinant Rat HMOX2 Protein | +Inquiry |
◆ Native Proteins | ||
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
HB-45R | Native Simian Hemoglobin (HB) Protein | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
IgG-341D | Native Dog IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXCT1-3508HCL | Recombinant Human OXCT1 293 Cell Lysate | +Inquiry |
CDC37-001MCL | Recombinant Mouse CDC37 cell lysate | +Inquiry |
ZNF131-1985HCL | Recombinant Human ZNF131 cell lysate | +Inquiry |
SERPINB3C-658MCL | Recombinant Mouse SERPINB3C cell lysate | +Inquiry |
PTPRJ-2675HCL | Recombinant Human PTPRJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbA Products
Required fields are marked with *
My Review for All psbA Products
Required fields are marked with *
0
Inquiry Basket