Recombinant Full Length Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged
Cat.No. : | RFL4967EF |
Product Overview : | Recombinant Full Length Large-conductance mechanosensitive channel(mscL) Protein (P0A743) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mscL |
Synonyms | mscL; Z4661; ECs4156; Large-conductance mechanosensitive channel |
UniProt ID | P0A743 |
◆ Recombinant Proteins | ||
HBM-5219H | Recombinant Human HBM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Csf1-333C | Active Recombinant Rat Csf1 Protein (155 aa) | +Inquiry |
RPL7A-3994R | Recombinant Rhesus monkey RPL7A Protein, His-tagged | +Inquiry |
AGR3-577H | Recombinant Human AGR3 Protein, Fc-tagged | +Inquiry |
CES3A-1605M | Recombinant Mouse CES3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
IgA-249P | Native Pig Immunoglobulin A | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A6A-4121HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
UBXN10-540HCL | Recombinant Human UBXN10 293 Cell Lysate | +Inquiry |
Bladder-30R | Rhesus monkey Bladder Lysate | +Inquiry |
GTF2F2-5699HCL | Recombinant Human GTF2F2 293 Cell Lysate | +Inquiry |
SUN1-1888HCL | Recombinant Human SUN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mscL Products
Required fields are marked with *
My Review for All mscL Products
Required fields are marked with *
0
Inquiry Basket