Recombinant Full Length Lactuca Sativa Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL25491LF |
Product Overview : | Recombinant Full Length Lactuca sativa NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q332S2) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactuca sativa (Garden lettuce) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQAINSFSILESLKEVYGIIWMLIPIFTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLVIPFSY HLVLADLSIGVFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFVPEVFEITKRGRV FGTIIGIFITLAKTYLFLFIPIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTCSQL ISL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q332S2 |
◆ Recombinant Proteins | ||
Insulin -53H | Active Recombinant Human Insulin | +Inquiry |
ADPRH-2518H | Recombinant Human ADP-Ribosylarginine Hydrolase, His-tagged | +Inquiry |
DCTN2-364HFL | Active Recombinant Full Length Human DCTN2 Protein, C-Flag-tagged | +Inquiry |
PIGY-3429R | Recombinant Rhesus monkey PIGY Protein, His-tagged | +Inquiry |
ARHGEF2-770R | Recombinant Rat ARHGEF2 Protein | +Inquiry |
◆ Native Proteins | ||
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spinal Cord-60H | Human Spinal Cord Tissue Lysate | +Inquiry |
Adrenal-552M | MiniPig Adrenal Lysate, Total Protein | +Inquiry |
Skeletal Muscle-436M | Mouse Skeletal Muscle Membrane Lysate | +Inquiry |
RAD51C-2555HCL | Recombinant Human RAD51C 293 Cell Lysate | +Inquiry |
Pericardium-229R | Rhesus monkey Heart: Pericardium Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket