Recombinant Full Length Lachancea Thermotolerans Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL21775LF |
Product Overview : | Recombinant Full Length Lachancea thermotolerans Probable endonuclease LCL3(LCL3) Protein (C5E2G4) (1-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea thermotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-266) |
Form : | Lyophilized powder |
AA Sequence : | MSEDRAVRLSSQQILYTKAAILSAALTGSILTSYALFNRYLKQYTRVTQIPLSAFRKNWL YGKVTSVGDGDNFHLFHTPGGILGGWGWARSAPKLDKVNNKRSDSLKRLFFPRFLRRQKE QEKFQSLNVPFKGRRNLPTLSIRLCGVDAPERAHFGNAAQPFSEEALIWLRHTLIGKFVW IKPLSLDQYGRCVAKVKFWSWTGWKNVSLEMVKNGIAVVYEGKTGAEFDDERDIYIFHEQ VARKERRGLWSLKKFETPGNYKKRVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCL3 |
Synonyms | LCL3; KLTH0H04752g; Probable endonuclease LCL3 |
UniProt ID | C5E2G4 |
◆ Recombinant Proteins | ||
Cd4-2276M | Active Recombinant Mouse Cd4 protein(Met1-Thr394), His-tagged | +Inquiry |
RFL25366CF | Recombinant Full Length Serpentine Receptor Class Beta-17(Srb-17) Protein, His-Tagged | +Inquiry |
Rhob-642M | Recombinant Mouse Rhob Protein, MYC/DDK-tagged | +Inquiry |
Cobl-914M | Recombinant Mouse Cobl Protein, MYC/DDK-tagged | +Inquiry |
SFTPC-5359R | Recombinant Rat SFTPC Protein | +Inquiry |
◆ Native Proteins | ||
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP85-3628HCL | Recombinant Human NUP85 293 Cell Lysate | +Inquiry |
RASSF1-2499HCL | Recombinant Human RASSF1 293 Cell Lysate | +Inquiry |
PKN1-1363HCL | Recombinant Human PKN1 cell lysate | +Inquiry |
SESN1-1585HCL | Recombinant Human SESN1 cell lysate | +Inquiry |
SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LCL3 Products
Required fields are marked with *
My Review for All LCL3 Products
Required fields are marked with *
0
Inquiry Basket