Recombinant Full Length L-Alanine Exporter Alae(Alae) Protein, His-Tagged
Cat.No. : | RFL33463YF |
Product Overview : | Recombinant Full Length L-alanine exporter AlaE(alaE) Protein (Q0WJC2) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MTMFSTGPRWRSAVADTFALVVYCFVIGMAIEVVISGMTFRQSLSSRLLSIPVNILIAWP YGMYRDAFIRFAQRHAGQRFWARNLADLLAYVSFQSPVYAMILWSVGADFEQMISAVASN AVVSMVMGVAYGYFLEYCRRLFRVAGYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alaE |
Synonyms | alaE; YPO0544; y3636; YP_3639; L-alanine exporter AlaE |
UniProt ID | Q0WJC2 |
◆ Native Proteins | ||
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
LDL-243H | Native Human Lipoproteins, Intermediate Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf65-8310HCL | Recombinant Human C12orf65 293 Cell Lysate | +Inquiry |
TP53I3-857HCL | Recombinant Human TP53I3 293 Cell Lysate | +Inquiry |
RPS16-2171HCL | Recombinant Human RPS16 293 Cell Lysate | +Inquiry |
PIH1D1-1205HCL | Recombinant Human PIH1D1 cell lysate | +Inquiry |
CRIP2-001HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All alaE Products
Required fields are marked with *
My Review for All alaE Products
Required fields are marked with *
0
Inquiry Basket