Recombinant Full Length Kluyveromyces Lactis Serine Palmitoyltransferase-Regulating Protein Tsc3(Tsc3) Protein, His-Tagged
Cat.No. : | RFL24733KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Serine palmitoyltransferase-regulating protein TSC3(TSC3) Protein (Q6CJH4) (1-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-84) |
Form : | Lyophilized powder |
AA Sequence : | MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA FCLHTIFLVVVSLSLFGLLKYIFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSC3 |
Synonyms | TSC3; KLLA0F18634g; Serine palmitoyltransferase-regulating protein TSC3 |
UniProt ID | Q6CJH4 |
◆ Recombinant Proteins | ||
SPP1-2680H | Recombinant Human SPP1 Protein, MYC/DDK-tagged | +Inquiry |
HSPA1A-2944R | Recombinant Rat HSPA1A protein, His-tagged | +Inquiry |
RPS26-10383Z | Recombinant Zebrafish RPS26 | +Inquiry |
LANCL2-6055H | Recombinant Human LANCL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL16994BF | Recombinant Full Length Burkholderia Mallei Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
LHX3-4750HCL | Recombinant Human LHX3 293 Cell Lysate | +Inquiry |
ODC1-3600HCL | Recombinant Human ODC1 293 Cell Lysate | +Inquiry |
Colon-97R | Rhesus monkey Colon transverse Lysate | +Inquiry |
UGT1A9-510HCL | Recombinant Human UGT1A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSC3 Products
Required fields are marked with *
My Review for All TSC3 Products
Required fields are marked with *
0
Inquiry Basket