Recombinant Full Length Kluyveromyces Lactis Ph-Response Regulator Protein Palh/Rim21(Rim21) Protein, His-Tagged
Cat.No. : | RFL26977KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis pH-response regulator protein palH/RIM21(RIM21) Protein (Q6CXK7) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MTGRSRWRYHFPSEDYSSCQGVQLDEGVLIWNKLPDKFAYIKSLVFTSNCQDGTPLYSSF VELEDECPYLPIVAFDWNSYINNDGYTGPFKYSIYSVIYSVTANFIITVFLTVIVFINVP TKPSRKASYILKLGALLASLNLSIFVIRVWKNIAENYTYNGYVSSTSFLNLLWGDKVFAG IDLVVVFLLQISQVQIVMRFFDRMQEKRMVFYFGLFLILVTQILWVIPTLSPVPTKDSDS DIDILPPFVYLFRIALSTCYASVICFHVLTKKSLCFRGRMIFLTLLTIFTVFLHPTFFIV DVSNLWIDDLSEIFNTTCYLASTVIVLEWTNRIHTMERKIHAASVLGRPIYEDEEQNFHF AIYALRMQNAMKMHRDGHVHDHGHTCDSNDNANVSLQNANTNDSSSIITDNSSQRTSTFG TMATDQVTLHTQQGERNITQFKRAETFWNKCHHVLESIVYYTDNVMVNALAGSKTFDSFT NDAEKLLKTERLRKTVGLDEPEDVYLYRKTTMSSDSVME |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM21 |
Synonyms | RIM21; KLLA0A07469g; pH-response regulator protein palH/RIM21 |
UniProt ID | Q6CXK7 |
◆ Recombinant Proteins | ||
MRGPRB13-3750R | Recombinant Rat MRGPRB13 Protein | +Inquiry |
UBLCP1-9852M | Recombinant Mouse UBLCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF13-12863H | Recombinant Human FGF13, GST-tagged | +Inquiry |
OR1F1-3183R | Recombinant Rhesus monkey OR1F1 Protein, His-tagged | +Inquiry |
APOO-642M | Recombinant Mouse APOO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ECGS-32B | Native Bovine ECGS | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Tuberculum Cinereum-75H | Human Tuberculum Cinereum Tissue Lysate | +Inquiry |
SMAP1-1673HCL | Recombinant Human SMAP1 293 Cell Lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
TCN2-1857MCL | Recombinant Mouse TCN2 cell lysate | +Inquiry |
Potato-392P | Plant Plant: Potato Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIM21 Products
Required fields are marked with *
My Review for All RIM21 Products
Required fields are marked with *
0
Inquiry Basket