Recombinant Full Length Kluyveromyces Lactis Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL24988KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Palmitoyltransferase PFA5(PFA5) Protein (Q6CRV3) (1-349aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-349) |
Form : | Lyophilized powder |
AA Sequence : | MAWSLGTLRVTSHPYFRLLIPFLTVLLQCYGVWAFCHQFCYLQLYQRRNAKGACIGLIIV VLSLTFLIWYIWALMLVLGPGRQPTIPPFKIIPDSEIRTVSSESAVPDNSIAPPDIYPCD ERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDL VVLILMISIATQMRQMKGSANGNVYAVFALACCALLMAGPLFLTHIYYMCYNRTSIEIIE VNNKAKASRKFFCIYNPCDGYRYVIQFCPGENQDFWNKGNILTNLKEFLGPNYLSWFIPS ILTHKQSYGKSSANYYDLIGDCNEVMSEKFQKYMIDKIERKEYVTRLVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; KLLA0D06149g; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q6CRV3 |
◆ Native Proteins | ||
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBLCP1-550HCL | Recombinant Human UBLCP1 293 Cell Lysate | +Inquiry |
FAM129A-6431HCL | Recombinant Human FAM129A 293 Cell Lysate | +Inquiry |
DDX42-456HCL | Recombinant Human DDX42 cell lysate | +Inquiry |
MMP26-4274HCL | Recombinant Human MMP26 293 Cell Lysate | +Inquiry |
OPALIN-1146HCL | Recombinant Human OPALIN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket