Recombinant Full Length Kluyveromyces Lactis Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL18532KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Palmitoyltransferase PFA4(PFA4) Protein (Q6CUB5) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY NDWGEDLSDFGVDTELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA4 |
Synonyms | PFA4; KLLA0C06204g; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q6CUB5 |
◆ Recombinant Proteins | ||
SPINLW1-646HF | Recombinant Full Length Human SPINLW1 Protein, GST-tagged | +Inquiry |
H2AFZ-218HF | Recombinant Full Length Human H2AFZ Protein | +Inquiry |
RPE-3235H | Recombinant Full Length Human RPE protein(Met1-Arg228), His-tagged | +Inquiry |
PHKG1-1074H | Active Recombinant Human PHKG1, GST-tagged | +Inquiry |
RFL20675SF | Recombinant Full Length Capsular Polysaccharide Biosynthesis Protein Cpsc(Cpsc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FSH-93P | Active Native Porcine FSH | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
ACT-161R | Native rabbit ACT | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
AVD-3786C | Native Chicken AVD | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHX1-4752HCL | Recombinant Human LHX1 293 Cell Lysate | +Inquiry |
HA-1565HCL | Recombinant H12N1 HA cell lysate | +Inquiry |
ACTR6-9046HCL | Recombinant Human ACTR6 293 Cell Lysate | +Inquiry |
ZNF174-136HCL | Recombinant Human ZNF174 293 Cell Lysate | +Inquiry |
SIRT3-1833HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA4 Products
Required fields are marked with *
My Review for All PFA4 Products
Required fields are marked with *
0
Inquiry Basket