Recombinant Full Length Kluyveromyces Lactis Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL15794KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Nuclear rim protein 1(NUR1) Protein (Q6CKY2) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MAFWRNRHESPAISQERSPSPDRFQNSEDIREDNNNYNEDEKLGWFASFMGMFSLPYDWY LSINEDIAVIDWDSKSNSVAWPLGNVLTFLFFSVRLLQDNVIAPNINKLTHSDDAFDFSK SKNLQKYDYFQQYGGSASSSENLYYKMLRQLHRLFYLLTVLLLITNISVTYRYLFAHFQT YSIFYWKTVPKSKNVTKKSLHDLNHTYVEDAKRDSLWGMIKYLLFNGSHDDETNRAHYYE LRKWTPSRFLTSFFVSFSPIAFCFLWMTDVTFKTLIPIIIHQYVLWFIVIDRYEQKLKDE QILSMSSVAELNSKVIQPKMNVLKQDAMVDATPYNDGIVYFYPAYTTTRSHVFATHTLSG KLSKEKYNPRTDSFEDANSQRTENYVRFSYHHPKSINGAYVRESYPSRQHSPRLSPSRYS HLQSGNTPSAPSTPLLIPSQQPHFDHSMLANASRNHNISERRNSHSPIKQHFANRLLNYP DETNDSIPDVSDDRFRMDDRFRRGRQGYFNRSPDINSGTLHYDDGDDDDNRISKSPFRNS SSSPFR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; KLLA0F07205g; Nuclear rim protein 1 |
UniProt ID | Q6CKY2 |
◆ Recombinant Proteins | ||
HIF1A-640H | Recombinant Human HIF1A | +Inquiry |
TFF1-244H | Active Recombinant Full Length Human TFF1 protein, Tag Free | +Inquiry |
Catalase-1608 | Recombinant Catalase Protein (M1-A483), Flag/His-tagged | +Inquiry |
CDHR1-954R | Recombinant Rat CDHR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TFF3-1046H | Recombinant Human TFF3, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-1116H | Native Human S100B Protein | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK3-517HCL | Recombinant Human PAK3 cell lysate | +Inquiry |
SIP1-1836HCL | Recombinant Human SIP1 293 Cell Lysate | +Inquiry |
NLRP10-3803HCL | Recombinant Human NLRP10 293 Cell Lysate | +Inquiry |
WDR92-327HCL | Recombinant Human WDR92 293 Cell Lysate | +Inquiry |
OTULIN-252HCL | Recombinant Human OTULIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket