Recombinant Full Length Klebsiella Pneumoniae Subsp. Pneumoniae Probable Intracellular Septation Protein A (Kpn78578_12170) Protein, His-Tagged
Cat.No. : | RFL13680KF |
Product Overview : | Recombinant Full Length Klebsiella pneumoniae subsp. pneumoniae Probable intracellular septation protein A (KPN78578_12170) Protein (A6T7V7) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MKQFLDFLPLVVFFAFYKLYDIYAATTALIVATAVVLIYSWVRYRKVEKMALITFVLVAV FGGLTIFFHNDEFIKWKVTVIYALFAGALLFSQWVMKKPLIQRMLGKELSLPQQVWSRLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLVFTLLSGIYIYRHMPQDDHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KPN78578_12170 |
Synonyms | yciB; KPN78578_12170; KPN_01245; Inner membrane-spanning protein YciB |
UniProt ID | A6T7V7 |
◆ Native Proteins | ||
MB-237C | Native Dog Myoglobin | +Inquiry |
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
GFP-36B | Native Bovine GFP | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX2-1448HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
YME1L1-242HCL | Recombinant Human YME1L1 293 Cell Lysate | +Inquiry |
Artery-35R | Rhesus monkey Blood Vessel: Artery Lysate | +Inquiry |
ACER1-9093HCL | Recombinant Human ACER1 293 Cell Lysate | +Inquiry |
ZNF23-114HCL | Recombinant Human ZNF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPN78578_12170 Products
Required fields are marked with *
My Review for All KPN78578_12170 Products
Required fields are marked with *
0
Inquiry Basket