Recombinant Full Length Klebsiella Pneumoniae Subsp. Pneumoniae Cobalamin Biosynthesis Protein Cobd(Cobd) Protein, His-Tagged
Cat.No. : | RFL22373KF |
Product Overview : | Recombinant Full Length Klebsiella pneumoniae subsp. pneumoniae Cobalamin biosynthesis protein CobD(cobD) Protein (A6TDC6) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MTLLAWCVAWILDVVIGDPPHWPHPVRWIGRLIAVSQRVVRRICHSDRALRIGGGVMWLV VIGLTWGVAWGVLALAHGIHPWLGWLVEVWMIFTALAGRCLAQSAMAVARPLQAGDLAES RHKLSWIVGRDTSQLQPAQINRAVVETVAENTVDGIIAPLFFLLLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARLDDVANFLPARLSWLLLSLAAVLCREDGARALRTGWRDRY QHSSPNCAWPEATVAGALGIRLGGPNDYFGQRVEKPWIGDAVRDIAVDDISRTIRLMWVA SSLALALFIGVRYWLVGAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cobD |
Synonyms | cobD; KPN78578_31360; KPN_03199; Cobalamin biosynthesis protein CobD |
UniProt ID | A6TDC6 |
◆ Recombinant Proteins | ||
FEZ1-2317R | Recombinant Rat FEZ1 Protein | +Inquiry |
MMP14-3649H | Recombinant Human MMP14 protein, His-tagged | +Inquiry |
PSMA6-3652R | Recombinant Rhesus monkey PSMA6 Protein, His-tagged | +Inquiry |
C19orf54-2577H | Recombinant Human C19orf54 protein, His-tagged | +Inquiry |
NXF2-2520H | Recombinant Human NXF2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDAH2-449HCL | Recombinant Human DDAH2 cell lysate | +Inquiry |
Human Adipose-242H | Human Human Adipose Lysate | +Inquiry |
CCDC67-160HCL | Recombinant Human CCDC67 lysate | +Inquiry |
CYSLTR2-7096HCL | Recombinant Human CYSLTR2 293 Cell Lysate | +Inquiry |
CLEC14A-2579MCL | Recombinant Mouse CLEC14A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cobD Products
Required fields are marked with *
My Review for All cobD Products
Required fields are marked with *
0
Inquiry Basket