Recombinant Full Length Invertebrate Iridescent Virus 6 Putative Myristoylated Membrane Protein 458R(Iiv6-458R) Protein, His-Tagged
Cat.No. : | RFL3459IF |
Product Overview : | Recombinant Full Length Invertebrate iridescent virus 6 Putative myristoylated membrane protein 458R(IIV6-458R) Protein (Q91F68) (2-495aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-495) |
Form : | Lyophilized powder |
AA Sequence : | GASVSSDITNTITCNLQEASNTILNNQNLNDHQGIFVNIIKIGDGNINANNFAEKSNASI DINALANALNNSSMNEDLNKKIAQTAKAAIKGVNLMQLGDANTTINDIVNTSIKVKNTAI QNLIIRFDQKIKINIYHIGKGNIKVKNVHLKEIHKIITKEVENAKNNNKDVTKLIEQFSQ ATESKVEGFSLKILSLIIFSTAFLGLGGVYVGGKIAFPVTLLLSILAFYQYFNWTDRTIF TDGFVDTMFNIDNDGCEALKNLTIENVKSAKGASDRCLKNPKCVAYNWNHNTKKITMFKG VLEEGCKNDILKNNTNETLFERKKLIVREGKKDPIMSTNGDLYLNNKNQTLWYNYKKKKQ NNWKELKNEKKIILDNSIKQGIDKFIKIIFGYEEKLPGPMPHTLYIDYSHNNHLKVFLCK LNFLIGKDFKNRDQSKDWTLISTIHLDIKMLDFEENDSCGVIVEQNKLWLLCVAVILLFI GIIGMGLGLKKNKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IIV6-458R |
Synonyms | IIV6-458R; Putative myristoylated membrane protein 458R |
UniProt ID | Q91F68 |
◆ Recombinant Proteins | ||
PTCHD1-7245M | Recombinant Mouse PTCHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP2-1875H | Recombinant Human CRIP2 Protein, GST-tagged | +Inquiry |
SMN1-2046H | Recombinant Human SMN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AOX1-8315Z | Recombinant Zebrafish AOX1 | +Inquiry |
YIPF3-6284R | Recombinant Rat YIPF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
EDN2-8310H | Native Human EDN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTX3-2102HCL | Recombinant Human PTX3 cell lysate | +Inquiry |
CFLAR-7553HCL | Recombinant Human CFLAR 293 Cell Lysate | +Inquiry |
SCFD2-1566HCL | Recombinant Human SCFD2 cell lysate | +Inquiry |
SPTSSA-8285HCL | Recombinant Human C14orf147 293 Cell Lysate | +Inquiry |
WIT1-305HCL | Recombinant Human WIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IIV6-458R Products
Required fields are marked with *
My Review for All IIV6-458R Products
Required fields are marked with *
0
Inquiry Basket