Recombinant Full Length Innexin-10(Inx-10) Protein, His-Tagged
Cat.No. : | RFL36622CF |
Product Overview : | Recombinant Full Length Innexin-10(inx-10) Protein (Q22549) (1-559aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-559) |
Form : | Lyophilized powder |
AA Sequence : | MVLAAVLSMLRYVGGSDDRDFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLVPDIFS SSWEQYAENYCWASDTYYVPTNEPVAGLQSDEKRQRKISYYQWVPFFLLLEAACFRLPSL LWKYLAGHSGIKINEIVKLSSDPNNIKPDIKRANIKSLTVHLQGALRFHRRLQKKQIRPH RFLWLFNLPYSAFFVTAMYLCTKFFYLANVCLQLMFMNRFLETDKYKWYGMGALVDLLNG TTWEQSGMFPRVSLCDFDVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFTFG SFFYWLLVSLWRHLNVRFIIRHLEMSDIAFDSSEDGAQEKVNRFISNYLKSDGVFVIRMM TLQSGVIFGTDLVQELWRNFHGSEPQLKRSNSAPKIEEREQWWPAYPSLVNPINPWRYRD ENQANALRWRRALGANVDNSIATQDLMEKLLPQNAHMRPSDDELLNRQPIAVQASYIDDE SDGKLKNEEKQNQQNATQPPYCYTNQNPTPYQNQNQIQNQNQYSNYYRTPSLSRGTDSRP VSTATDTDQTKKQSMSTFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inx-10 |
Synonyms | inx-10; opu-10; T18H9.5; Innexin-10; Protein opu-10 |
UniProt ID | Q22549 |
◆ Recombinant Proteins | ||
IL15RA-1653H | Recombinant Human Interleukin 15 Receptor, Alpha, Fc-His | +Inquiry |
RFL15432BF | Recombinant Full Length Bacillus Subtilis Undecaprenyl-Diphosphatase Bcrc(Bcrc) Protein, His-Tagged | +Inquiry |
HSD3B7-2591R | Recombinant Rat HSD3B7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Golga7-3269M | Recombinant Mouse Golga7 Protein, Myc/DDK-tagged | +Inquiry |
ICAM1-627H | Recombinant Human ICAM1 Protein (Gln48-Glu480), C-mFc-tagged | +Inquiry |
◆ Native Proteins | ||
LDHA-8315C | Native Chicken LDHA | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
Lectin-1764C | Active Native Succinylated Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP4A-351HCL | Recombinant Human CHMP4A cell lysate | +Inquiry |
C16orf87-86HCL | Recombinant Human C16orf87 lysate | +Inquiry |
SRPRB-1473HCL | Recombinant Human SRPRB 293 Cell Lysate | +Inquiry |
RNF10-2311HCL | Recombinant Human RNF10 293 Cell Lysate | +Inquiry |
DUSP11-6783HCL | Recombinant Human DUSP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All inx-10 Products
Required fields are marked with *
My Review for All inx-10 Products
Required fields are marked with *
0
Inquiry Basket