Recombinant Full Length Inner Membrane Transport Permease Ybhr(Ybhr) Protein, His-Tagged
Cat.No. : | RFL21839SF |
Product Overview : | Recombinant Full Length Inner membrane transport permease ybhR(ybhR) Protein (P0AFQ1) (1-368aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-368) |
Form : | Lyophilized powder |
AA Sequence : | MFHRLWTLIRKELQSLLREPQTRAILILPVLIQVILFPFAATLEVTNATIAIYDEDNGEH SVELTQRFARASAFTHVLLLKSPQEIRPTIDTQKALLLVRFPADFSRKLDTFQTAPLQLI LDGRNSNSAQIAANYLQQIVKNYQQELLEGKPKPNNSELVVRNWYNPNLDYKWFVVPSLI AMITTIGVMIVTSLSVAREREQGTLDQLLVSPLTTWQIFIGKAVPALIVATFQATIVLAI GIWAYQIPFAGSLALFYFTMVIYGLSLVGFGLLISSLCSTQQQAFIGVFVFMMPAILLSG YVSPVENMPVWLQNLTWINPIRHFTDITKQIYLKDASLDIVWNSLWPLLVITATTGSAAY AMFRRKVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhR |
Synonyms | ybhR; SF0742; S0783; Probable multidrug ABC transporter permease YbhR |
UniProt ID | P0AFQ1 |
◆ Recombinant Proteins | ||
DEPTOR-5182H | Recombinant Human DEPTOR Protein, GST-tagged | +Inquiry |
ARHGAP8-2702H | Recombinant Human ARHGAP8 Protein, MYC/DDK-tagged | +Inquiry |
GPX4-33H | Recombinant Human GPX4 Protein, His-tagged | +Inquiry |
TEX19.1-9142M | Recombinant Mouse TEX19.1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL705SF | Recombinant Full Length Streptomyces Coelicolor Nadh-Quinone Oxidoreductase Subunit K 2(Nuok2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
F9-300R | Native Rat Factor IX | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
LDL-242H | Native Human Lipoproteins, High Density | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTR9-7195HCL | Recombinant Human CTR9 293 Cell Lysate | +Inquiry |
RNF32-1527HCL | Recombinant Human RNF32 cell lysate | +Inquiry |
ENTPD7-6590HCL | Recombinant Human ENTPD7 293 Cell Lysate | +Inquiry |
HLA-F-331HCL | Recombinant Human HLA-F lysate | +Inquiry |
IFITM2-5282HCL | Recombinant Human IFITM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybhR Products
Required fields are marked with *
My Review for All ybhR Products
Required fields are marked with *
0
Inquiry Basket