Recombinant Full Length Inner Membrane Transport Permease Ybhr(Ybhr) Protein, His-Tagged
Cat.No. : | RFL4742EF |
Product Overview : | Recombinant Full Length Inner membrane transport permease ybhR(ybhR) Protein (P0AFQ0) (1-368aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-368) |
Form : | Lyophilized powder |
AA Sequence : | MFHRLWTLIRKELQSLLREPQTRAILILPVLIQVILFPFAATLEVTNATIAIYDEDNGEH SVELTQRFARASAFTHVLLLKSPQEIRPTIDTQKALLLVRFPADFSRKLDTFQTAPLQLI LDGRNSNSAQIAANYLQQIVKNYQQELLEGKPKPNNSELVVRNWYNPNLDYKWFVVPSLI AMITTIGVMIVTSLSVAREREQGTLDQLLVSPLTTWQIFIGKAVPALIVATFQATIVLAI GIWAYQIPFAGSLALFYFTMVIYGLSLVGFGLLISSLCSTQQQAFIGVFVFMMPAILLSG YVSPVENMPVWLQNLTWINPIRHFTDITKQIYLKDASLDIVWNSLWPLLVITATTGSAAY AMFRRKVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhR |
Synonyms | ybhR; Z1012; ECs0870; Probable multidrug ABC transporter permease YbhR |
UniProt ID | P0AFQ0 |
◆ Recombinant Proteins | ||
KIZ-5680Z | Recombinant Zebrafish KIZ | +Inquiry |
Il21-581R | Recombinant Rat Il21 protein | +Inquiry |
ADH1C-77H | Recombinant Human ADH1C Protein, His&GST-tagged | +Inquiry |
DCUN1D1-1024R | Recombinant Rhesus Macaque DCUN1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POLR3GLA-1353Z | Recombinant Zebrafish POLR3GLA | +Inquiry |
◆ Native Proteins | ||
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
TF-71R | Native Rat Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
POMT2-3016HCL | Recombinant Human POMT2 293 Cell Lysate | +Inquiry |
HeLa-8H | HeLa Whole Cell Lysate - Etoposide Stimulated | +Inquiry |
PRAP1-002HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
SCARB1-2699HCL | Recombinant Human SCARB1 cell lysate | +Inquiry |
CYP1B1-7125HCL | Recombinant Human CYP1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybhR Products
Required fields are marked with *
My Review for All ybhR Products
Required fields are marked with *
0
Inquiry Basket