Recombinant Full Length Inner Membrane Protein Yibh(Yibh) Protein, His-Tagged
Cat.No. : | RFL26877EF |
Product Overview : | Recombinant Full Length Inner membrane protein yibH(yibH) Protein (P0AFV1) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM RKVLLRMTSWMHYLYLDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yibH |
Synonyms | yibH; Z5021; ECs4473; Inner membrane protein YibH |
UniProt ID | P0AFV1 |
◆ Recombinant Proteins | ||
PUM1-2069H | Recombinant Human PUM1 protein, His-tagged | +Inquiry |
PDLIM5-4644H | Recombinant Human PDLIM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRKRA-1960H | Recombinant Human PRKRA, GST-tagged | +Inquiry |
HGF-9876B | Recombinant Bovine HGF protein, His-tagged | +Inquiry |
RFL3157DF | Recombinant Full Length Desulfitobacterium Hafniense Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
IgG-351C | Native Cat IgG | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRMP1-7273HCL | Recombinant Human CRMP1 293 Cell Lysate | +Inquiry |
FAM108A1-6459HCL | Recombinant Human FAM108A1 293 Cell Lysate | +Inquiry |
FLAG-088CL | DYKDDDDK (FLAG) Positive Control Lysate | +Inquiry |
KIT-1324RCL | Recombinant Rat KIT cell lysate | +Inquiry |
IRAK1BP1-5172HCL | Recombinant Human IRAK1BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yibH Products
Required fields are marked with *
My Review for All yibH Products
Required fields are marked with *
0
Inquiry Basket