Recombinant Full Length Inner Membrane Protein Ybhq(Ybhq) Protein, His-Tagged
Cat.No. : | RFL2101EF |
Product Overview : | Recombinant Full Length Inner membrane protein ybhQ(ybhQ) Protein (P0AAW6) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLCALYCVTVVMMLVFQR HPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAIAGLAILAGPAVVSLLA KDKKLHHLTSKHRVRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhQ |
Synonyms | ybhQ; c0874; Inner membrane protein YbhQ |
UniProt ID | P0AAW6 |
◆ Native Proteins | ||
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
Thrombin-29B | Active Native Bovine alpha-Thrombin-FPRck | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDH2-8472HCL | Recombinant Human BDH2 293 Cell Lysate | +Inquiry |
CHRFAM7A-7522HCL | Recombinant Human CHRFAM7A 293 Cell Lysate | +Inquiry |
REC8-2431HCL | Recombinant Human REC8 293 Cell Lysate | +Inquiry |
C1orf54-639HCL | Recombinant Human C1orf54 cell lysate | +Inquiry |
FAM133B-6428HCL | Recombinant Human FAM133B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybhQ Products
Required fields are marked with *
My Review for All ybhQ Products
Required fields are marked with *
0
Inquiry Basket