Recombinant Full Length Influenza B Virus Glycoprotein Nb(Nb) Protein, His-Tagged
Cat.No. : | RFL3727IF |
Product Overview : | Recombinant Full Length Influenza B virus Glycoprotein NB(NB) Protein (P16196) (1-100aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza B virus (strain B/Maryland/1959) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-100) |
Form : | Lyophilized powder |
AA Sequence : | MNNATFNYTNVNPISHIRGSIIITICVSFTVILIVFGHIAKIFTNKKNCTNNVIRVRERI KCSGCEPFCNKRDDISSPRARVDIPSFILPGLNLSESTPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NB |
Synonyms | NB; Glycoprotein NB |
UniProt ID | P16196 |
◆ Recombinant Proteins | ||
ARFGAP3-211R | Recombinant Rhesus Macaque ARFGAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Armh1-3239M | Recombinant Mouse Armh1 Protein, Myc/DDK-tagged | +Inquiry |
CXCL2-2287HF | Recombinant Full Length Human CXCL2 Protein, GST-tagged | +Inquiry |
AKR1B15-3267H | Recombinant Human AKR1B15, His-tagged | +Inquiry |
RFL33240CF | Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase 2(Lgt2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-577M | MiniPig Spleen Lysate, Total Protein | +Inquiry |
GRK6-622HCL | Recombinant Human GRK6 cell lysate | +Inquiry |
HA-2326HCL | Recombinant H16N3 HA cell lysate | +Inquiry |
ASTE1-8638HCL | Recombinant Human ASTE1 293 Cell Lysate | +Inquiry |
PTPLA-2689HCL | Recombinant Human PTPLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NB Products
Required fields are marked with *
My Review for All NB Products
Required fields are marked with *
0
Inquiry Basket