Recombinant Full Length Influenza A Virus Neuraminidase(Na) Protein, His-Tagged
Cat.No. : | RFL15835IF |
Product Overview : | Recombinant Full Length Influenza A virus Neuraminidase(NA) Protein (Q2ICQ7) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Memphis/101/1972 H3N2) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MNPNQKIITIGSVSLTIATICFLMQIAILVTTVTLHFKQYECDSPANNQVMPCEPIIIER NITEIVYLTNTTIEKEICPKLVEYRNWSKPQCKITGFAPFSKDNSIRLSAGGDIWVTREP YVSCDPGKCYQFALGQGTTLDNKHSNDTIHDRTPHRTLLMNELGVPFHLGTRQVCIAWSS SSCHDGKAWLHVCVTGYDKNATASFIYDGRLVDSIGSWSQNILRTQESECVCINGTCTVV MTDGSASGRADTKILFIEEGKIVHISPLSGSAQHVEECSCYPRYPGVRCICRDNWKGSNR PVVDINVKDYSIDSSYVCSGLVGDTPRNNDRSSNSYCRNPNNEKGNHGVKGWAFDDGNDV WMGRTISEDSRSGYETFKVIGGWSTPNSKLQINRQVIVDSDNRSGYSGIFSVEGKSCINR CFYVELIRGREQETRVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NA |
Synonyms | NA; Neuraminidase |
UniProt ID | Q2ICQ7 |
◆ Recombinant Proteins | ||
LRATD1-1314H | Recombinant Human LRATD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMC4-1638H | Recombinant Human CMC4 | +Inquiry |
GPT2-1808H | Recombinant Human GPT2 protein(1-523aa), His&Myc-tagged | +Inquiry |
CCL20-2729H | Recombinant Human CCL20 Protein (Ser27-Met96), His tagged | +Inquiry |
SRD5A1-495HF | Recombinant Full Length Human SRD5A1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIPT-201HCL | Recombinant Human CRIPT lysate | +Inquiry |
NRDE2-8293HCL | Recombinant Human C14orf102 293 Cell Lysate | +Inquiry |
ACTL6A-9062HCL | Recombinant Human ACTL6A 293 Cell Lysate | +Inquiry |
CSRP2BP-7231HCL | Recombinant Human CSRP2BP 293 Cell Lysate | +Inquiry |
C9orf117-136HCL | Recombinant Human C9orf117 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NA Products
Required fields are marked with *
My Review for All NA Products
Required fields are marked with *
0
Inquiry Basket