Recombinant Full Length Influenza A Virus Matrix Protein 2(M2) Protein, His-Tagged
Cat.No. : | RFL2717IF |
Product Overview : | Recombinant Full Length Influenza A virus Matrix protein 2(M2) Protein (A4U7A7) (1-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/USA:Albany/12/1951 H1N1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-97) |
Form : | Lyophilized powder |
AA Sequence : | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVNIELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; M2; Matrix protein 2; Proton channel protein M2 |
UniProt ID | A4U7A7 |
◆ Native Proteins | ||
IgG-514H | Native Human IgG | +Inquiry |
C3-012H | Native Human Complement C3c | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF80-6HCL | Recombinant Human ZNF80 293 Cell Lysate | +Inquiry |
LPGAT1-4669HCL | Recombinant Human LPGAT1 293 Cell Lysate | +Inquiry |
Balb-150M | 3T3 Balb Whole Cell Lysate | +Inquiry |
KLRG1-950HCL | Recombinant Human KLRG1 cell lysate | +Inquiry |
C19orf10-218HCL | Recombinant Human C19orf10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket