Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged
Cat.No. : | RFL18201IF |
Product Overview : | Recombinant Full Length Influenza A virus Matrix protein 2(M) Protein (Q77W49) (1-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Turkey/Oregon/1971 H7N3) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-97) |
Form : | Lyophilized powder |
AA Sequence : | MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; Matrix protein 2; Proton channel protein M2 |
UniProt ID | Q77W49 |
◆ Recombinant Proteins | ||
MYOZ2-2495H | Recombinant Human MYOZ2 Protein, His-tagged | +Inquiry |
DUSP16-102H | Recombinant Human DUSP16, GST-tagged | +Inquiry |
EEPD1-3078H | Recombinant Human EEPD1 Protein, GST-tagged | +Inquiry |
DCLRE1B-3855HF | Recombinant Full Length Human DCLRE1B Protein, GST-tagged | +Inquiry |
RFL23169DF | Recombinant Full Length Danio Rerio Fat Storage-Inducing Transmembrane Protein 1(Fitm1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
IgG1 Fc-08H | Native Human Immunoglobulin G1 (IgG1) FC Fragment | +Inquiry |
ICDH-209S | Active Native Swine Isocitrate Dehydrogenase | +Inquiry |
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLCN4-7474HCL | Recombinant Human CLCN4 293 Cell Lysate | +Inquiry |
DPM3-6833HCL | Recombinant Human DPM3 293 Cell Lysate | +Inquiry |
CYP1A2-432HCL | Recombinant Human CYP1A2 cell lysate | +Inquiry |
NCL-1174HCL | Recombinant Human NCL cell lysate | +Inquiry |
MUS81-4056HCL | Recombinant Human MUS81 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket