Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged
Cat.No. : | RFL23653IF |
Product Overview : | Recombinant Full Length Influenza A virus Matrix protein 2(M) Protein (Q67166) (1-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Duck/Czechoslovakia/1956 H4N6) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-97) |
Form : | Lyophilized powder |
AA Sequence : | MSLLTEVETPTRNGWECRYSGSSDPLVIAASIIGILHLILWILDRLFFKCIYRCLKHGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; Matrix protein 2; Proton channel protein M2 |
UniProt ID | Q67166 |
◆ Recombinant Proteins | ||
SCO1523-1332S | Recombinant Streptomyces coelicolor A3(2) SCO1523 protein, His-tagged | +Inquiry |
GNAI3-380H | Recombinant Human GNAI3 protein, MYC/DDK-tagged | +Inquiry |
CD3D-0799H | Recombinant Human CD3D Protein | +Inquiry |
NOC2-1322H | Recombinant Human NOC2, GST-tagged | +Inquiry |
RFL9814PF | Recombinant Full Length Pseudomonas Syringae Pv. Tomato Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HPX-207H | Native Human Hemopexin | +Inquiry |
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBASH3B-2142HCL | Recombinant Human UBASH3B cell lysate | +Inquiry |
ARF5-8757HCL | Recombinant Human ARF5 293 Cell Lysate | +Inquiry |
OR2K2-3562HCL | Recombinant Human OR2K2 293 Cell Lysate | +Inquiry |
TSTA3-691HCL | Recombinant Human TSTA3 293 Cell Lysate | +Inquiry |
SMURF1-1647HCL | Recombinant Human SMURF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket