Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged
Cat.No. : | RFL5465IF |
Product Overview : | Recombinant Full Length Influenza A virus Matrix protein 2(M) Protein (P03492) (1-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Fowl plague virus/Rostock/8/1934 H7N1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-97) |
Form : | Lyophilized powder |
AA Sequence : | MSLLTEVETPTRNGWECRCNDSSDPLIIAASIIGILHLILWILNRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; Matrix protein 2; Proton channel protein M2 |
UniProt ID | P03492 |
◆ Recombinant Proteins | ||
PLA2G15-295C | Recombinant Chinese hamster PLA2G15 protein, His-tagged | +Inquiry |
LOXL1-629M | Recombinant Mouse LOXL1 Protein (95-607 aa), His-tagged | +Inquiry |
TMUB1-12486Z | Recombinant Zebrafish TMUB1 | +Inquiry |
RFL28195PF | Recombinant Full Length Probable Disulfide Formation Protein Protein, His-Tagged | +Inquiry |
NFS1-02H | Recombinant Human NFS1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGFA-2940HCL | Recombinant Human HGFA cell lysate | +Inquiry |
CPT1C-7298HCL | Recombinant Human CPT1C 293 Cell Lysate | +Inquiry |
PRDM15-1410HCL | Recombinant Human PRDM15 cell lysate | +Inquiry |
GAS2L3-688HCL | Recombinant Human GAS2L3 cell lysate | +Inquiry |
Lung-109M | Mouse Lung Tissue Lysate (7 Days Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket