Recombinant Full Length Human ZG16 Protein, GST-tagged

• Cat.No.: ZG16-5919HF
• Product Overview: Human LOC653808 full-length ORF (BAG54214.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ZG16 (Zymogen Granule Protein 16) is a Protein Coding gene. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ZG16B.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.6 kDa
• Protein length: 167 amino acids
• AA Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZG16 zymogen granule protein 16 [ Homo sapiens (human) ]
• Official Symbol: ZG16
• Synonyms: ZG16; zymogen granule protein 16; JCLN; JCLN1; ZG16A; FLJ43571; FLJ92276; MGC34820; MGC183567; zymogen granule membrane protein 16; jacalin-like lectin domain containing; secretory lectin ZG16; zymogen granule protein 16 homolog
• Gene ID: 653808
• mRNA Refseq: NM_152338
• Protein Refseq: NP_689551
• MIM: 617311
• UniProt ID: O60844