Recombinant Full Length Human ZG16 Protein, GST-tagged

Cat.No. : ZG16-5919HF
Product Overview : Human LOC653808 full-length ORF (BAG54214.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 167 amino acids
Description : ZG16 (Zymogen Granule Protein 16) is a Protein Coding gene. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ZG16B.
Molecular Mass : 44.6 kDa
AA Sequence : MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZG16 zymogen granule protein 16 [ Homo sapiens (human) ]
Official Symbol ZG16
Synonyms ZG16; zymogen granule protein 16; JCLN; JCLN1; ZG16A; FLJ43571; FLJ92276; MGC34820; MGC183567; zymogen granule membrane protein 16; jacalin-like lectin domain containing; secretory lectin ZG16; zymogen granule protein 16 homolog
Gene ID 653808
mRNA Refseq NM_152338
Protein Refseq NP_689551
MIM 617311
UniProt ID O60844

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZG16 Products

Required fields are marked with *

My Review for All ZG16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon