Recombinant Full Length Human ZBTB7A Protein, C-Flag-tagged
Cat.No. : | ZBTB7A-613HFL |
Product Overview : | Recombinant Full Length Human ZBTB7A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including SMAD binding activity; androgen receptor binding activity; and transcription corepressor binding activity. Involved in several processes, including erythrocyte maturation; negative regulation of signal transduction; and regulation of nucleobase-containing compound metabolic process. Located in cytoplasm and nucleus. Colocalizes with DNA-dependent protein kinase complex and NuRD complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.3 kDa |
AA Sequence : | MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVD QQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADA GQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVA AGDCNGLDFYGPGPPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEA ASLSEAAPEPGDSPGFLSGAAEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMD YYLKYFSGAHDGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGC NGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAG AGGGGDSGGGPGAATDGNFTAGLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | ZBTB7A zinc finger and BTB domain containing 7A [ Homo sapiens (human) ] |
Official Symbol | ZBTB7A |
Synonyms | LRF; FBI1; FBI-1; TIP21; ZBTB7; MNDLFH; ZNF857A; pokemon |
Gene ID | 51341 |
mRNA Refseq | NM_015898.4 |
Protein Refseq | NP_056982.1 |
MIM | 605878 |
UniProt ID | O95365 |
◆ Recombinant Proteins | ||
ZBTB7A-10287M | Recombinant Mouse ZBTB7A Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB7A-6649R | Recombinant Rat ZBTB7A Protein | +Inquiry |
Zbtb7a-2429M | Recombinant Mouse Zbtb7a, His-tagged | +Inquiry |
Zbtb7a-1336M | Recombinant Mouse Zbtb7a Protein, MYC/DDK-tagged | +Inquiry |
ZBTB7A-6305R | Recombinant Rat ZBTB7A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB7A-1957HCL | Recombinant Human ZBTB7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZBTB7A Products
Required fields are marked with *
My Review for All ZBTB7A Products
Required fields are marked with *
0
Inquiry Basket