Recombinant Full Length Human XPNPEP2 Protein, C-Flag-tagged
Cat.No. : | XPNPEP2-1925HFL |
Product Overview : | Recombinant Full Length Human XPNPEP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75.4 kDa |
AA Sequence : | MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYI IPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPI VTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEA FTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKS RFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPV MMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETIS ASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLS RLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYK DGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQ RRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | XPNPEP2 X-prolyl aminopeptidase 2 [ Homo sapiens (human) ] |
Official Symbol | XPNPEP2 |
Synonyms | APP2; AEACEI |
Gene ID | 7512 |
mRNA Refseq | NM_003399.6 |
Protein Refseq | NP_003390.4 |
MIM | 300145 |
UniProt ID | O43895 |
◆ Recombinant Proteins | ||
XPNPEP2-230H | Active Recombinant Human XPNPEP2, His-tagged | +Inquiry |
XPNPEP2-6575H | Recombinant Human XPNPEP2 Protein (Gly21-Ala650), C-His tagged | +Inquiry |
XPNPEP2-1534R | Recombinant Rat XPNPEP2 protein, His-tagged | +Inquiry |
XPNPEP2-1419H | Recombinant Human XPNPEP2 protein, His-tagged | +Inquiry |
XPNPEP2-2366H | Recombinant Human XPNPEP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XPNPEP2-1901HCL | Recombinant Human XPNPEP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XPNPEP2 Products
Required fields are marked with *
My Review for All XPNPEP2 Products
Required fields are marked with *
0
Inquiry Basket